PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00015.1.g01740.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 397aa    MW: 42591.9 Da    PI: 5.0248
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00015.1.g01740.1.sm.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like31.53.9e-10116139225
                       G2-like   2 prlrWtpeLHerFveaveqLGGse 25 
                                   prlrWt eLH+rFv av++LGG++
  Zjn_sc00015.1.g01740.1.sm.mk 116 PRLRWTRELHARFVLAVSELGGAD 139
                                   8*********************97 PP

2G2-like47.83.2e-151622001755
                       G2-like  17 aveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                    +  LG + +AtPk++l++m v gLtl+hvkS LQkYR+
  Zjn_sc00015.1.g01740.1.sm.mk 162 TIFFLGVTAEATPKSVLRVMAVRGLTLHHVKSYLQKYRT 200
                                   566699999*****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.3E-26114140IPR009057Homeodomain-like
SuperFamilySSF466892.69E-10114140IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-11162200IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.606.3E-26172204IPR009057Homeodomain-like
SuperFamilySSF466892.69E-10173202IPR009057Homeodomain-like
PfamPF143791.0E-8253288IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MAYWRGRVGH GCLVTHIPFP PRLRAGASCI CATGITEEEY IRAVESKETN LLSAQPVSES  60
SGSAPPAAAA SHAGGHATDA ATPRDVDFDT LEMASSGGGG VYAGQSGGEA AAGRSPRLRW  120
TRELHARFVL AVSELGGADS ESSLIGARFP LRLSALVLMI KTIFFLGVTA EATPKSVLRV  180
MAVRGLTLHH VKSYLQKYRT AVSRGLGTVT ADNGEGQNDW SSSSENEYNE EDRAFAGDEG  240
EALCDSSRSV AWMQREVRRN LQDQIERRLQ LRIEAQGRYL ESLLRRAYDV PADHSLGSPA  300
EAAETEHSEI TSPAVSTSSS SLSSSPPRHV STDSCVTSSS SSEAESKTRR RCTCADAREC  360
TVDQPVQSKR DVLQGDAEEA EEDADTENGS SEIDLNR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973515.11e-68PREDICTED: myb family transcription factor APL-like
TrEMBLA0A0A9EY773e-76A0A0A9EY77_ARUDO; Uncharacterized protein
STRINGSi014218m3e-68(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP112643038
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.18e-27G2-like family protein